STRA13 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-55505

Product Code. 18266191

Description

STRA13 Polyclonal specifically detects STRA13 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: STRA13
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: BHLHE40, CENPX, CENP-X, DEC1, FAAP10, FANCM-interacting histone fold protein 2, Fanconi anemia-associated polypeptide of 10 kDa, HLHB2, MGC14480, MHF2centromere protein X, Retinoic acid-inducible gene D9 protein homolog, stimulated by retinoic acid 13, stimulated by retinoic acid 13 homolog (mouse), Stimulated by retinoic acid gene 13 protein homolog
• Host Species: Rabbit
• Molecular Weight of Antigen: 7 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: A8MT69-2
• Gene Symbols: CENPX
• Immunogen: Synthetic peptides corresponding to STRA13(stimulated by retinoic acid 13 homolog (mouse)) The peptide sequence was selected from the middle region of STRA13. Peptide sequence MEGAGAGSGFRKELVSRLLHLHFKDDKTKEAAVRGVRQAQAEDALRVDVD.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 201254
• Target Species: Human
• Isotype: IgG