missing translation for 'onlineSavingsMsg'
Learn More
Learn More
STAM-1 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£149.00 - £366.00
Specifications
| Antigen | STAM-1 |
|---|---|
| Dilution | Western Blot 1:200-1:1000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18658122
|
Novus Biologicals
NBP2-94882-0.02ml |
0.02 mL |
£149.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18693002
|
Novus Biologicals
NBP2-94882-0.1ml |
0.1 mL |
£366.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
STAM-1 Polyclonal antibody specifically detects STAM-1 in Human, Mouse, Rat samples. It is validated for Western BlotSpecifications
| STAM-1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cell Biology, Cell Cycle and Replication, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 8027 | |
| IgG | |
| Affinity purified |
| Western Blot 1:200-1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| DKFZp686J2352, HSE1 homolog, signal transducing adapter molecule 1, signal transducing adaptor molecule (SH3 domain and ITAM motif) 1, STAM1STAM-1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 120-210 of human STAM (NP_003464.1). KNDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVANKKEEEDLAKAIELSLKEQRQQSTTLSTLYPSTSSLLTNHQH | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title