missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. STAM-1 Antibody - BSA Free, Novus Biologicals™

STAM-1 Antibody - BSA Free, Novus Biologicals™

Product Code. 18658122 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.02mL
0.1mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18658122 0.02 mL 0.02mL
18693002 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18658122 Supplier Novus Biologicals Supplier No. NBP2948820.02ml

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

STAM-1 Polyclonal antibody specifically detects STAM-1 in Human, Mouse, Rat samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen STAM-1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:200-1:1000
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias DKFZp686J2352, HSE1 homolog, signal transducing adapter molecule 1, signal transducing adaptor molecule (SH3 domain and ITAM motif) 1, STAM1STAM-1
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 120-210 of human STAM (NP_003464.1). KNDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVANKKEEEDLAKAIELSLKEQRQQSTTLSTLYPSTSSLLTNHQH
Purification Method Affinity purified
Quantity 0.02 mL
Regulatory Status RUO
Research Discipline Cell Biology, Cell Cycle and Replication, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 8027
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.