missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SRP9 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£153.00 - £366.00
Specifications
| Antigen | SRP9 |
|---|---|
| Dilution | Western Blot 1:1000-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18667470
|
Novus Biologicals
NBP2-93528-0.02ml |
0.02 mL |
£153.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18653451
|
Novus Biologicals
NBP2-93528-0.1ml |
0.1 mL |
£366.00
0.01mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SRP9 Polyclonal antibody specifically detects SRP9 in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/ ImmunofluorescenceSpecifications
| SRP9 | |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Human, Mouse | |
| ALURBP, MGC110981, signal recognition particle 9 kDa protein, signal recognition particle 9kD, signal recognition particle 9kDa | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of human SRP9 (NP_003124.1). MPQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVCLVYKTDQAQDVKKIEKFHSQLMRLMVAKEARNVTMETE | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:1000-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 6726 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title