missing translation for 'onlineSavingsMsg'
Learn More

SRP9 Antibody - BSA Free, Novus Biologicals™

Product Code. 18667470 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.01mL
0.02mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18667470 0.02 mL 0.02mL
18653451 0.1 mL 0.01mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18667470 Supplier Novus Biologicals Supplier No. NBP2935280.02ml

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

SRP9 Polyclonal antibody specifically detects SRP9 in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen SRP9
Applications Western Blot, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias ALURBP, MGC110981, signal recognition particle 9 kDa protein, signal recognition particle 9kD, signal recognition particle 9kDa
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of human SRP9 (NP_003124.1). MPQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVCLVYKTDQAQDVKKIEKFHSQLMRLMVAKEARNVTMETE
Purification Method Affinity purified
Quantity 0.02 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6726
Target Species Human, Mouse
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.