missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SRC1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £488.00
Specifications
| Antigen | SRC1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18217222
|
Novus Biologicals
NBP2-57610 |
100 μL |
£488.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18671708
|
Novus Biologicals
NBP2-57610-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SRC1 Polyclonal specifically detects SRC1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| SRC1 | |
| Polyclonal | |
| Rabbit | |
| Cancer, Chromatin Research, Transcription Factors and Regulators | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 8648 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PTSRLNRLPELELEAIDNQFGQPGTGDQIPWTNNTVTAINQSKSEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETEL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| bHLHe42, BHLHE74, Class E basic helix-loop-helix protein 74, EC 2.3.1.48, Hin-2 protein, KAT13A, MGC129719, NCoA-1, nuclear receptor coactivator 1, PAX3/NCOA1 fusion protein, Protein Hin-2, Renal carcinoma antigen NY-REN-52, RIP160bHLHe74F-SRC-1, SRC-1, SRC1MGC129720, Steroid receptor coactivator 1, steroid receptor coactivator-1 | |
| NCOA1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title