SRC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-57610

Product Code. 18217222

Description

SRC1 Polyclonal specifically detects SRC1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: SRC1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: bHLHe42, BHLHE74, Class E basic helix-loop-helix protein 74, EC 2.3.1.48, Hin-2 protein, KAT13A, MGC129719, NCoA-1, nuclear receptor coactivator 1, PAX3/NCOA1 fusion protein, Protein Hin-2, Renal carcinoma antigen NY-REN-52, RIP160bHLHe74F-SRC-1, SRC-1, SRC1MGC129720, Steroid receptor coactivator 1, steroid receptor coactivator-1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: NCOA1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PTSRLNRLPELELEAIDNQFGQPGTGDQIPWTNNTVTAINQSKSEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETEL
• Quantity: 100 μL
• Research Discipline: Cancer, Chromatin Research, Transcription Factors and Regulators
• Gene ID (Entrez): 8648
• Target Species: Human
• Isotype: IgG

For Research Use Only