Testican 3/SPOCK3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-59703

Product Code. 18217223

Description

Testican 3/SPOCK3 Polyclonal specifically detects Testican 3/SPOCK3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Testican 3/SPOCK3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CWCV, and Kazal-like domains proteoglycan 3, HSAJ1454, sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3, TES-3, testican 3, TICN3
• Host Species: Rabbit
• Molecular Weight of Antigen: 49 kDa
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 50859
• Target Species: Human, Mouse, Rat, Pig, Canine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9BQ16-1
• Gene Symbols: SPOCK3
• Immunogen: Synthetic peptides corresponding to SPOCK3(sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3) The peptide sequence was selected from the middle region of SPOCK3. Peptide sequence VDRYGNEVMGSRINGVADCAIDFEISGDFASGDFHEWTDDEDDEDDIMND The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.