missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SRBD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | SRBD1 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Description
SRBD1 Polyclonal specifically detects SRBD1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SRBD1 | |
| Unconjugated | |
| RUO | |
| FLJ10379, H_NH0576F01.1, S1 RNA binding domain 1, S1 RNA-binding domain-containing protein 1, WUGSC:H_NH0576F01.1 | |
| SRBD1 | |
| IgG |
| Polyclonal | |
| Rabbit | |
| Q8N5C6 | |
| 55133 | |
| Synthetic peptides corresponding to SRBD1(S1 RNA binding domain 1) The peptide sequence was selected from the N terminal of SRBD1. Peptide sequence MSSLPRRAKVQVQDVVLKDEFSSFSELSSASEEDDKEDSAWEPQKKVPRS. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title