SR-BI Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18648728	Novus Biologicals NBP2-62676-25ul	25 μL
18699576	Novus Biologicals NBP2-62676	100 μg

Description

SR-BI Polyclonal antibody specifically detects SR-BI in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: SR-BI
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Host Species: Rabbit
• Research Discipline: Breast Cancer, Cancer, Cardiovascular Biology, Cholesterol Metabolism, Lipid and Metabolism, Signal Transduction, Virology Bacteria and Parasites
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Gene ID (Entrez): 949
• Isotype: IgG
• Purification Method: Protein A purified

• Dilution: Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Classification: Polyclonal
• Form: Purified
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: CD36 and LIMPII analogous 1, CD36 antigen, CD36 antigen (collagen type I receptor, thrombospondin receptor)-like 1, CD36L1scavenger receptor class B type 1, CLA1 CD36 antigen-like 1, CLA-1 HDLQTL6, Collagen type I receptor, thrombospondin receptor-like 1, MGC138242, SCARB1, scavenger receptor class B type III, scavenger receptor class B, member 1, SR-B1, SRB1 scavenger receptor class B member 1, SRBI
• Immunogen: This SR-BI Antibody was developed against a recombinant protein corresponding to amino acids: CYLFWSSSKKGSKDKEAIQAYSESLMTSAPKGSVLQEAKL
• Primary or Secondary: Primary
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.