missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SR-BI Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-62676-25ul
This item is not returnable.
View return policy
Description
SR-BI Polyclonal antibody specifically detects SR-BI in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| SR-BI | |
| Polyclonal | |
| Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| CD36 and LIMPII analogous 1, CD36 antigen, CD36 antigen (collagen type I receptor, thrombospondin receptor)-like 1, CD36L1scavenger receptor class B type 1, CLA1 CD36 antigen-like 1, CLA-1 HDLQTL6, Collagen type I receptor, thrombospondin receptor-like 1, MGC138242, SCARB1, scavenger receptor class B type III, scavenger receptor class B, member 1, SR-B1, SRB1 scavenger receptor class B member 1, SRBI | |
| This SR-BI Antibody was developed against a recombinant protein corresponding to amino acids: CYLFWSSSKKGSKDKEAIQAYSESLMTSAPKGSVLQEAKL | |
| 25 μL | |
| Breast Cancer, Cancer, Cardiovascular Biology, Cholesterol Metabolism, Lipid and Metabolism, Signal Transduction, Virology Bacteria and Parasites | |
| 949 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction