missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SPSB1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£155.00 - £364.00
Specifications
| Antigen | SPSB1 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
SPSB1 Polyclonal antibody specifically detects SPSB1 in Human, Mouse, Rat samples. It is validated for Western BlotSpecifications
| SPSB1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 80176 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| novel SPRY domain containing protein, splA/ryanodine receptor domain and SOCS box containing 1, SPRY domain-containing SOCS box protein 1, SSB-1SPRY domain-containing SOCS box protein SSB-1, SSB1SPSB | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human SPSB1 (NP_079382.2). MGQKVTGGIKTVDMRDPTYRPLKQELQGLDYCKPTRLDLLLDMPPVSYDVQLLHSWNNND | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title