SPSB1 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-94732-0.1ml

Product Code. 18653342

Description

SPSB1 Polyclonal antibody specifically detects SPSB1 in Human, Mouse, Rat samples. It is validated for Western Blot

Specifications

• Antigen: SPSB1
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:2000
• Gene Alias: novel SPRY domain containing protein, splA/ryanodine receptor domain and SOCS box containing 1, SPRY domain-containing SOCS box protein 1, SSB-1SPRY domain-containing SOCS box protein SSB-1, SSB1SPSB
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human SPSB1 (NP_079382.2). MGQKVTGGIKTVDMRDPTYRPLKQELQGLDYCKPTRLDLLLDMPPVSYDVQLLHSWNNND
• Quantity: 0.1 mL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 80176
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified