missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SPRY3 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£149.00 - £366.00
Specifications
| Antigen | SPRY3 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Produktcode | Marke | Quantity | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Quantity | Preis | Menge & Verfügbarkeit | |||||
|
18618090
|
Novus Biologicals
NBP2-93748-0.02ml |
0.02 mL |
£149.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18676120
|
Novus Biologicals
NBP2-93748-0.1ml |
0.1 mL |
£366.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beschreibung
SPRY3 Polyclonal antibody specifically detects SPRY3 in Human samples. It is validated for Western BlotSpezifikation
| SPRY3 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cell Biology, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 10251 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| Antagonist Of FGF Signaling, HSPRY3, Protein Sprouty Homolog 3, sprouty (Drosophila) homolog 2, Sprouty Homolog 3 (Drosophila), spry-3 | |
| A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human SPRY3 (NP_005831.1). TDDEDNCADEPCSCGPSSCFVRWAAMSLISLFLPCLCCYLPTRGCLHLCQQGYDSLRRPGCRCKRHTNTVCRKISSGSAPFPKAQEKSV | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts