missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SPRY3 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93748-0.1ml
This item is not returnable.
View return policy
Description
SPRY3 Polyclonal antibody specifically detects SPRY3 in Human samples. It is validated for Western Blot
Specifications
| SPRY3 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| Antagonist Of FGF Signaling, HSPRY3, Protein Sprouty Homolog 3, sprouty (Drosophila) homolog 2, Sprouty Homolog 3 (Drosophila), spry-3 | |
| A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human SPRY3 (NP_005831.1). TDDEDNCADEPCSCGPSSCFVRWAAMSLISLFLPCLCCYLPTRGCLHLCQQGYDSLRRPGCRCKRHTNTVCRKISSGSAPFPKAQEKSV | |
| 0.1 mL | |
| Cell Biology, Signal Transduction | |
| 10251 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction