missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Splicing factor, arginine/serine-rich 11 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Splicing factor, arginine/serine-rich 11 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Splicing factor, arginine/serine-rich 11 Polyclonal specifically detects Splicing factor, arginine/serine-rich 11 in Human samples. It is validated for Western Blot.Specifications
| Splicing factor, arginine/serine-rich 11 | |
| Polyclonal | |
| Rabbit | |
| Q05519 | |
| 9295 | |
| Synthetic peptides corresponding to SFRS11(splicing factor, arginine/serine-rich 11) The peptide sequence was selected from the C terminal of SFRS11. Peptide sequence KKKSKDKEKDRERKSESDKDVKQVTRDYDEEEQGYDSEKEKKEEKKPIET. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Arginine-rich 54 kDa nuclear protein, dJ677H15.2, DKFZp686M13204, p54NET2, serine/arginine-rich splicing factor 11, SFRS11, splicing factor p54, Splicing factor, arginine/serine-rich 11FLJ18226, SR splicing factor 11 | |
| SRSF11 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title