missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SPC18 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£359.00
Specifications
| Antigen | SPC18 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
SPC18 Polyclonal specifically detects SPC18 in Mouse samples. It is validated for Western Blot.Specifications
| SPC18 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Mouse | |
| EC 3.4, Endopeptidase SP18, Microsomal signal peptidase 18 kDa subunit, SEC11 homolog A, SEC11 homolog A (S. cerevisiae), SEC11L1, SEC11-like 1, SEC11-like protein 1, sid2895, signal peptidase complex (18kD), signal peptidase complex catalytic subunit SEC11A, SPase 18 kDa subunit, SPC18SEC11-like 1 (S. cerevisiae), SPCS4A1810012E07Rik | |
| The immunogen is a synthetic peptide directed towards the middle region of mouse SPC18 (NP_064335.1). Peptide sequence EIPIVHRVLKIHEKQDGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVG | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 23478 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title