SPC18 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-10181-100UL

Product Code. 18352625

Description

SPC18 Polyclonal specifically detects SPC18 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: SPC18
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: EC 3.4, Endopeptidase SP18, Microsomal signal peptidase 18 kDa subunit, SEC11 homolog A, SEC11 homolog A (S. cerevisiae), SEC11L1, SEC11-like 1, SEC11-like protein 1, sid2895, signal peptidase complex (18kD), signal peptidase complex catalytic subunit SEC11A, SPase 18 kDa subunit, SPC18SEC11-like 1 (S. cerevisiae), SPCS4A1810012E07Rik
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse SPC18 (NP_064335.1). Peptide sequence EIPIVHRVLKIHEKQDGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVG
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Mouse
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 23478
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.