missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SPATA6L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | C9orf68 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SPATA6L Polyclonal specifically detects SPATA6L in Human samples. It is validated for Western Blot.Specifications
| C9orf68 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| bA6J24.2, C9orf68, chromosome 9 open reading frame 68, FLJ10058, hypothetical protein LOC55064, RP11-280I16.2, spermatogenesis associated 6-like | |
| SPATA6L | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8N4H0 | |
| 55064 | |
| Synthetic peptides corresponding to C9ORF68 The peptide sequence was selected from the middle region of C9ORF68. Peptide sequence CLDSSQFGKSSSSKQGDADFHGKASFATYQHSTSPGPLDQPLLRERFHPG. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title