SPATA6L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-56828

Product Code. 18289722

Description

SPATA6L Polyclonal specifically detects SPATA6L in Human samples. It is validated for Western Blot.

Specifications

• Antigen: C9orf68
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: bA6J24.2, C9orf68, chromosome 9 open reading frame 68, FLJ10058, hypothetical protein LOC55064, RP11-280I16.2, spermatogenesis associated 6-like
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55064
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8N4H0
• Gene Symbols: SPATA6L
• Immunogen: Synthetic peptides corresponding to C9ORF68 The peptide sequence was selected from the middle region of C9ORF68. Peptide sequence CLDSSQFGKSSSSKQGDADFHGKASFATYQHSTSPGPLDQPLLRERFHPG.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%.
• Target Species: Human
• Isotype: IgG