missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SPATA2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | SPATA2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SPATA2 Polyclonal specifically detects SPATA2 in Human samples. It is validated for Western Blot.Specifications
| SPATA2 | |
| Polyclonal | |
| Rabbit | |
| NP_001129245 | |
| 9825 | |
| Synthetic peptide directed towards the C terminal of human SPATA2The immunogen for this antibody is SPATA2. Peptide sequence DRLPHLHSKSKPSTTPTSRCGFCNRPGATNTCTQCSKVSCDACLSAYHYD. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| KIAA0757FLJ13167, PD1spermatogenesis associated PD1, spermatogenesis associated 2, spermatogenesis-associated protein 2, Spermatogenesis-associated protein PD1, tamo | |
| SPATA2 | |
| IgG | |
| 58 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title