missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SPATA2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-79736
This item is not returnable.
View return policy
Description
SPATA2 Polyclonal specifically detects SPATA2 in Human samples. It is validated for Western Blot.
Specifications
| SPATA2 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| KIAA0757FLJ13167, PD1spermatogenesis associated PD1, spermatogenesis associated 2, spermatogenesis-associated protein 2, Spermatogenesis-associated protein PD1, tamo | |
| Rabbit | |
| 58 kDa | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Dog: 86%; Pig: 86%; Rat: 86%; Guinea pig: 86%; Mouse: 85%; Horse: 79%. | |
| Human, Mouse, Rat, Canine, Equine, Guinea Pig | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| NP_001129245 | |
| SPATA2 | |
| Synthetic peptide directed towards the C terminal of human SPATA2The immunogen for this antibody is SPATA2. Peptide sequence DRLPHLHSKSKPSTTPTSRCGFCNRPGATNTCTQCSKVSCDACLSAYHYD. | |
| Affinity purified | |
| RUO | |
| 9825 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction