missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SNX29 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£378.00
Specifications
| Antigen | SNX29 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
SNX29 Polyclonal specifically detects SNX29 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SNX29 | |
| Polyclonal | |
| Purified | |
| RUO | |
| A-388D4.1, FLJ00143, FLJ12363, FLJ40609, RUN domain containing 2A, sorting nexin 29 | |
| SNX29 | |
| IgG | |
| Protein A purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| NP_115543 | |
| 92017 | |
| Synthetic peptide directed towards the N terminal of human RUNDC2AThe immunogen for this antibody is RUNDC2A. Peptide sequence MSGSQNNDKRQFLLERLLDAVKQCQIRFGGRKEIASDSDSRVTCLCAQFE. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title