missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SNRPG Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £623.00
Specifications
| Antigen | SNRPG |
|---|---|
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18101878
|
Novus Biologicals
NBP2-38045 |
0.1 mL |
£623.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18623336
|
Novus Biologicals
NBP2-38045-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SNRPG Polyclonal specifically detects SNRPG in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SNRPG | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P62308 | |
| 6637 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: RHVQGILRGFDPFMNLVIDECVEMATSGQQ | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| DNA replication Transcription Translation and Splicing | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| MGC117317, PBSCG, small nuclear ribonucleoprotein G, small nuclear ribonucleoprotein polypeptide G, SMG, Sm-GSm protein G, snRNP-G | |
| SNRPG | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title