SNAP43 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-80296

Product Code. 18277675

Description

SNAP43 Polyclonal specifically detects SNAP43 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SNAP43
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Proximal sequence element-binding transcription factor subunit gamma, PSE-binding factor subunit gamma, PTF subunit gamma, PTFgamma, small nuclear RNA activating complex, polypeptide 1, 43kD, small nuclear RNA activating complex, polypeptide 1, 43kDa, Small nuclear RNA-activating complex polypeptide 1, SNAP43SNAPc 43 kDa subunit, SNAPc subunit 1, snRNA-activating protein complex 43 kDa subunit, snRNA-activating protein complex subunit 1
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%.
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_003073
• Gene Symbols: SNAPC1
• Immunogen: Synthetic peptide directed towards the C terminal of human SNAPC1. Peptide sequence GQGQVKATRKKEKKERLKPAGRKMSLRNKGNVQNIHKEDKPLSLSMPVIT.
• Quantity: 100 μL
• Research Discipline: DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 6617
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG