Smad5 Antibody, Novus Biologicals™

Rabbit Monoclonal Antibody

Brand:  Novus Biologicals NBP3-33193-100ul

Product Code. 30226667

Beskrivning

Smad5 Monoclonal antibody specifically detects Smad5 in Human,Mouse samples. It is validated for ELISA,Immunoprecipitation,Western Blot

Specifikationer

• Antigen: Smad5
• Classification: Monoclonal
• Dilution: Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL, Immunoprecipitation 0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells
• Gene Alias: hSmad5, JV5-1DKFZp781O1323, MAD homolog 5, MAD, mothers against decapentaplegic homolog 5 (Drosophila), MADH5mothers against decapentaplegic homolog 5, mothers against decapentaplegic homolog 5, mothers against decapentaplegic, drosophila, homolog of, 5, Mothers against DPP homolog 5, SMA- and MAD-related protein 5, SMAD 5, SMAD family member 5DKFZp781C1895, SMAD, mothers against DPP homolog 5, SMAD, mothers against DPP homolog 5 (Drosophila), Smad5
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Smad5 (Q99717).,, Sequence:, STYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMDTSNNMIPQIMPSISSRDVQPVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFT
• Quantity: 100 μL
• Research Discipline: Phospho Specific, Signal Transduction
• Gene ID (Entrez): 4090
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: ELISA, Immunoprecipitation, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Form: Purified