missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLCO3A1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | SLCO3A1 |
|---|---|
| Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18671529
|
Novus Biologicals
NBP2-68838-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18606186
|
Novus Biologicals
NBP2-68838 |
100 μg |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SLCO3A1 Polyclonal antibody specifically detects SLCO3A1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| SLCO3A1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cell Biology, Neuroscience, Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol | |
| 28232 | |
| IgG | |
| Protein A purified |
| Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| FLJ40478, OATP3A1OATP-RP3, OATP-DOATPRP3, OATPDSLC21A11, Organic anion transporter polypeptide-related protein 3, Organic anion-transporting polypeptide D, PGE1 transporter, Sodium-independent organic anion transporter D, solute carrier family 21 (organic anion transporter), member 11, Solute carrier family 21 member 11, solute carrier organic anion transporter family member 3A1, solute carrier organic anion transporter family, member 3A1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LPEFLTHQYKYEAGEIRWGAEGRDVCAANGSGGDEGPDPDLICRNRTATNM | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title