SLCO3A1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-68838

Product Code. 18606186

Description

SLCO3A1 Polyclonal antibody specifically detects SLCO3A1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: SLCO3A1
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Alias: FLJ40478, OATP3A1OATP-RP3, OATP-DOATPRP3, OATPDSLC21A11, Organic anion transporter polypeptide-related protein 3, Organic anion-transporting polypeptide D, PGE1 transporter, Sodium-independent organic anion transporter D, solute carrier family 21 (organic anion transporter), member 11, Solute carrier family 21 member 11, solute carrier organic anion transporter family member 3A1, solute carrier organic anion transporter family, member 3A1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LPEFLTHQYKYEAGEIRWGAEGRDVCAANGSGGDEGPDPDLICRNRTATNM
• Quantity: 100 μg
• Research Discipline: Cell Biology, Neuroscience, Signal Transduction
• Gene ID (Entrez): 28232
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified