SLCO1C1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Novus Biologicals NBP1-59642

Código de producto. 18286241

Descripción

SLCO1C1 Polyclonal specifically detects SLCO1C1 in Human samples. It is validated for Western Blot.

Especificaciones

• Antigen: SLCO1C1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: OATP1, OATP14Thyroxine transporter, OATP1C1Solute carrier family 21 member 14, OATPFOAT-RP-5, OATP-FOrganic anion-transporting polypeptide 14, OATPRP5, Organic anion transporter F, Organic anion transporter polypeptide-related protein 5, organic anion transporting polypeptide 14, SLC21A14OATP-14, solute carrier family 21 (organic anion transporter), member 14, solute carrier organic anion transporter family member 1C1, solute carrier organic anion transporter family, member 1C1
• Host Species: Rabbit
• Molecular Weight of Antigen: 79 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Yeast 83%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9NYB5
• Gene Symbols: SLCO1C1
• Immunogen: Synthetic peptides corresponding to SLCO1C1 (solute carrier organic anion transporter family, member 1C1). The peptide sequence was selected from the N terminal of SLCO1C1. Peptide sequence VDTSSSMWIYVFLGNLLRGIGETPIQPLGIAYLDDFASEDNAAFYIGCVQ.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 53919
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.