SLC7A7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-59856

Product Code. 18264825

Description

SLC7A7 Polyclonal specifically detects SLC7A7 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SLC7A7
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: LAT3, LPI, Monocyte amino acid permease 2, MOP-2, solute carrier family 7 (cationic amino acid transporter, y+ system), member 7, Solute carrier family 7 member 7, Y+L amino acid transporter 1, Y+LAT1, y+LAT-1y(+)L-type amino acid transporter 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 56 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Guinea pig 79%, Mouse 79%, Rat 79%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9UM01
• Gene Symbols: SLC7A7
• Immunogen: Synthetic peptides corresponding to SLC7A7(solute carrier family 7 (cationic amino acid transporter, y+ system), member 7) The peptide sequence was selected from the middle region of SLC7A7. Peptide sequence WGTLVQDIFTYAKVLALIAVIVAGIVRLGQGASTHFENSFEGSSFAVGDI The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9056
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.