missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC7A4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-59750
This item is not returnable.
View return policy
Description
SLC7A4 Polyclonal specifically detects SLC7A4 in Human samples. It is validated for Western Blot.
Specifications
| SLC7A4 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| SLC7A4 | |
| Synthetic peptides corresponding to SLC7A4(solute carrier family 7 (cationic amino acid transporter, y+ system), member 4) The peptide sequence was selected from the middle region of SLC7A4. Peptide sequence GAYILVSTVLTLMVPWHSLDPDSALADAFYQRGYRWAGFIVAAGSICAMN The peptide sequence for this immunogen was taken from within the described region. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Guinea pig: 100%; Mouse: 100%; Rat: 100%; Bovine: 85%; Canine: 84%; Pig: 84%; Equine: 78%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| CAT4cationic amino acid transporter 4, CAT-4MGC129977, HCAT3, Ig heavy chain variable region, MGC129976, solute carrier family 7 (cationic amino acid transporter, y+ system), member 4, Solute carrier family 7 member 4, VH, VH 3 family | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 6545 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction