missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC6A19 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£342.00 - £470.00
Specifications
| Antigen | SLC6A19 |
|---|---|
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18437440
|
Novus Biologicals
NBP1-86277-25ul |
25 μL |
£342.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18275486
|
Novus Biologicals
NBP1-86277 |
0.1 mL |
£470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SLC6A19 Polyclonal specifically detects SLC6A19 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SLC6A19 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| B0AT1, FLJ20680, FLJ34635, HND, sodium-dependent amino acid transporter system B0, sodium-dependent neutral amino acid transporter B(0)AT1, solute carrier family 6 (neurotransmitter transporter), member 19, solute carrier family 6 (neutral amino acid transporter), member 19, Solute carrier family 6 member 19, System B(0) neutral amino acid transporter AT1, system B0 neutral amino acid transporter | |
| SLC6A19 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 340024 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:GFRATQRYDDCFSTNILTLINGFDLPEGNVTQENFVDMQQRCNASDPAAYAQLVFQTCDINAFLSEAVEGT | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title