SLC6A19 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-86277-25ul

Product Code. 18437440

Description

SLC6A19 Polyclonal specifically detects SLC6A19 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SLC6A19
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: B0AT1, FLJ20680, FLJ34635, HND, sodium-dependent amino acid transporter system B0, sodium-dependent neutral amino acid transporter B(0)AT1, solute carrier family 6 (neurotransmitter transporter), member 19, solute carrier family 6 (neutral amino acid transporter), member 19, Solute carrier family 6 member 19, System B(0) neutral amino acid transporter AT1, system B0 neutral amino acid transporter
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 340024
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SLC6A19
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:GFRATQRYDDCFSTNILTLINGFDLPEGNVTQENFVDMQQRCNASDPAAYAQLVFQTCDINAFLSEAVEGT
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only