missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC6A14 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£161.00 - £366.00
Specifications
| Antigen | SLC6A14 |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18629820
|
Novus Biologicals
NBP2-93247-0.02ml |
0.02 mL |
£161.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18637100
|
Novus Biologicals
NBP2-93247-0.1ml |
0.1 mL |
£366.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SLC6A14 Polyclonal antibody specifically detects SLC6A14 in Human, Mouse samples. It is validated for Western BlotSpecifications
| SLC6A14 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cancer, Endocrinology, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 11254 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| Amino acid transporter ATB0+, amino acid transporter B0+, BMIQ11, OBX, sodium- and chloride-dependent neutral and basic amino acid transporter B(0+), solute carrier family 6 (amino acid transporter), member 14, solute carrier family 6 (neurotransmitter transporter), member 14, Solute carrier family 6 member 14 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 131-234 of human SLC6A14 (NP_009162.1). YYNVIIAYSLYYMFASFQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNKGIQEIIQMNKSWVDINNFTCINGSEIYQPGQLPSEQYWNKVALQRSSGMNETGV | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title