missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC6A14 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93247-0.1ml
This item is not returnable.
View return policy
Description
SLC6A14 Polyclonal antibody specifically detects SLC6A14 in Human, Mouse samples. It is validated for Western Blot
Specifications
| SLC6A14 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000 | |
| Amino acid transporter ATB0+, amino acid transporter B0+, BMIQ11, OBX, sodium- and chloride-dependent neutral and basic amino acid transporter B(0+), solute carrier family 6 (amino acid transporter), member 14, solute carrier family 6 (neurotransmitter transporter), member 14, Solute carrier family 6 member 14 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 131-234 of human SLC6A14 (NP_009162.1). YYNVIIAYSLYYMFASFQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNKGIQEIIQMNKSWVDINNFTCINGSEIYQPGQLPSEQYWNKVALQRSSGMNETGV | |
| 0.1 mL | |
| Cancer, Endocrinology, Signal Transduction | |
| 11254 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction