missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC4A5 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£153.00 - £366.00
Specifications
| Antigen | SLC4A5 |
|---|---|
| Dilution | Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18660771
|
Novus Biologicals
NBP2-93493-0.02ml |
0.02 mL |
£153.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18613880
|
Novus Biologicals
NBP2-93493-0.1ml |
0.1 mL |
£366.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SLC4A5 Polyclonal antibody specifically detects SLC4A5 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| SLC4A5 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cancer, Endocrinology, Neuroscience, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 57835 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| electrogenic sodium bicarbonate cotransporter 4, MGC129662, NBC4Solute carrier family 4 member 5, NBCe2, solute carrier family 4, sodium bicarbonate cotransporter, member 5 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1042-1121 of human SLC4A5 (NP_597812.1). DFIFSQHDLAWIDNILPEKEKKETDKKRKRKKGAHEDCDEEPQFPPPSVIKIPMESVQSDPQNGIHCIARKRSSSWSYSL | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title