missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC4A5 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93493-0.1ml
This item is not returnable.
View return policy
Description
SLC4A5 Polyclonal antibody specifically detects SLC4A5 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| SLC4A5 | |
| Polyclonal | |
| Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin | |
| electrogenic sodium bicarbonate cotransporter 4, MGC129662, NBC4Solute carrier family 4 member 5, NBCe2, solute carrier family 4, sodium bicarbonate cotransporter, member 5 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1042-1121 of human SLC4A5 (NP_597812.1). DFIFSQHDLAWIDNILPEKEKKETDKKRKRKKGAHEDCDEEPQFPPPSVIKIPMESVQSDPQNGIHCIARKRSSSWSYSL | |
| 0.1 mL | |
| Cancer, Endocrinology, Neuroscience, Signal Transduction | |
| 57835 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction