missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC45A2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-59786
This item is not returnable.
View return policy
Description
SLC45A2 Polyclonal specifically detects SLC45A2 in Human samples. It is validated for Western Blot.
Specifications
| SLC45A2 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| AIM-1, AIM11A1, MATPmembrane associated transporter, Melanoma antigen AIM1, membrane-associated transporter protein, Protein AIM-1, SHEP5, Solute carrier family 45 member 2, solute carrier family 45, member 2, underwhite | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Expected identity based on immunogen sequence: Human: 100%; Canine: 92%; Equine: 92%; Pig: 92%; Bovine: 85%; Mouse: 85%; Rat: 85%. | |
| Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q6P2P0 | |
| SLC45A2 | |
| The immunogen is a synthetic peptide directed towards the C terminal region of human SLC45A2. Peptide Sequence IGWTAFLSNMLFFTDFMGQIVYRGDPYSAHNSTEFLIYERGVEVGCWGFC. The peptide sequence for this immunogen was taken from within the described region. | |
| 100 μL | |
| Breast Cancer | |
| 51151 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction