missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC39A12 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£380.00
Specifications
| Antigen | SLC39A12 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SLC39A12 Polyclonal specifically detects SLC39A12 in Human samples. It is validated for Western Blot.Specifications
| SLC39A12 | |
| Polyclonal | |
| Rabbit | |
| Q504Y0-3 | |
| 221074 | |
| Synthetic peptides corresponding to SLC39A12(solute carrier family 39 (zinc transporter), member 12) The peptide sequence was selected from the N terminal of SLC39A12. Peptide sequence MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| bA570F3.1, FLJ30499, LIV-1 subfamily of ZIP zinc transporter 8, LZT-Hs8, MGC43205, MGC51099, solute carrier family 39 (metal ion transporter), member 12, solute carrier family 39 (zinc transporter), member 12, Solute carrier family 39 member 12, zinc transporter ZIP12, ZIP12, ZIP-12, Zrt- and Irt-like protein 12 | |
| SLC39A12 | |
| IgG | |
| 73 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title