missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC39A12 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£161.00 - £375.00
Specifications
| Antigen | SLC39A12 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18693540
|
Novus Biologicals
NBP2-93599-0.02ml |
0.02 mL |
£161.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18643170
|
Novus Biologicals
NBP2-93599-0.1ml |
0.1 mL |
£375.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SLC39A12 Polyclonal antibody specifically detects SLC39A12 in Human, Mouse, Rat samples. It is validated for Western BlotSpecifications
| SLC39A12 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cancer, Endocrinology, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 221074 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| bA570F3.1, FLJ30499, LIV-1 subfamily of ZIP zinc transporter 8, LZT-Hs8, MGC43205, MGC51099, solute carrier family 39 (metal ion transporter), member 12, solute carrier family 39 (zinc transporter), member 12, Solute carrier family 39 member 12, zinc transporter ZIP12, ZIP12, ZIP-12, Zrt- and Irt-like protein 12 | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SLC39A12 (NP_001138667.1). MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVLSAGDHPPHNHSRSLIKTLLEKTGCPRRRNGMQGDCNLCFEPDALLLIAGG | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title