SLC39A12 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-93599-0.1ml

Product Code. 18643170

Description

SLC39A12 Polyclonal antibody specifically detects SLC39A12 in Human, Mouse, Rat samples. It is validated for Western Blot

Specifications

• Antigen: SLC39A12
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:2000
• Gene Alias: bA570F3.1, FLJ30499, LIV-1 subfamily of ZIP zinc transporter 8, LZT-Hs8, MGC43205, MGC51099, solute carrier family 39 (metal ion transporter), member 12, solute carrier family 39 (zinc transporter), member 12, Solute carrier family 39 member 12, zinc transporter ZIP12, ZIP12, ZIP-12, Zrt- and Irt-like protein 12
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SLC39A12 (NP_001138667.1). MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVLSAGDHPPHNHSRSLIKTLLEKTGCPRRRNGMQGDCNLCFEPDALLLIAGG
• Quantity: 0.1 mL
• Research Discipline: Cancer, Endocrinology, Signal Transduction
• Gene ID (Entrez): 221074
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified