missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC30A4 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£157.00 - £364.00
Specifications
| Antigen | SLC30A4 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
SLC30A4 Polyclonal antibody specifically detects SLC30A4 in Human, Mouse samples. It is validated for Western BlotSpecifications
| SLC30A4 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Endocrinology, Neuroscience, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 7782 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| solute carrier family 30 (zinc transporter), member 4, zinc transporter 4, znT-4, ZNT4Solute carrier family 30 member 4 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 335-429 of human SLC30A4 (NP_037441.2). VPSHLNVDYIKEALMKIEDVYSVEDLNIWSLTSGKSTAIVHIQLIPGSSSKWEEVQSKANHLLLNTFGMYRCTIQLQSYRQEVDRTCANCQSSSP | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title