missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC25A44 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£171.00 - £386.00
Specifications
| Antigen | SLC25A44 |
|---|---|
| Dilution | Western Blot 1:1000 - 1:5000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18655830
|
Novus Biologicals
NBP2-94720-0.02ml |
0.02 mL |
£171.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18604141
|
Novus Biologicals
NBP2-94720-0.1ml |
0.1 mL |
£386.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SLC25A44 Polyclonal antibody specifically detects SLC25A44 in Human, Mouse, Rat samples. It is validated for Western BlotSpecifications
| SLC25A44 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cancer, Endocrinology, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 9673 | |
| IgG | |
| Affinity purified |
| Western Blot 1:1000 - 1:5000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| KIAA0446FLJ90431, RP11-54H19.3, solute carrier family 25 member 44, solute carrier family 25, member 44 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 140-184 of human SLC25A44 (NP_055470.1). QRKGEKMGRFQVRGNPEGQGVVAFGQTKDIIRQILQADGLRGFYR | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title