missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC25A44 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94720-0.1ml
This item is not returnable.
View return policy
Description
SLC25A44 Polyclonal antibody specifically detects SLC25A44 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| SLC25A44 | |
| Polyclonal | |
| Western Blot 1:1000 - 1:5000 | |
| KIAA0446FLJ90431, RP11-54H19.3, solute carrier family 25 member 44, solute carrier family 25, member 44 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 140-184 of human SLC25A44 (NP_055470.1). QRKGEKMGRFQVRGNPEGQGVVAFGQTKDIIRQILQADGLRGFYR | |
| 0.1 mL | |
| Cancer, Endocrinology, Signal Transduction | |
| 9673 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction