missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC23A2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£161.00 - £366.00
Specifications
| Antigen | SLC23A2 |
|---|---|
| Dilution | Western Blot 1:1000 - 1:5000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18697182
|
Novus Biologicals
NBP2-94907-0.02ml |
0.02 mL |
£161.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18647802
|
Novus Biologicals
NBP2-94907-0.1ml |
0.1 mL |
£366.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SLC23A2 Polyclonal antibody specifically detects SLC23A2 in Human, Mouse samples. It is validated for Western BlotSpecifications
| SLC23A2 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human, Mouse | |
| KIAA0238SLC23A1, Na(+)/L-ascorbic acid transporter 2, Nucleobase transporter-like 1 protein, Sodium-dependent vitamin C transporter 2, sodium-dependent vitamin C transporter-2, solute carrier family 23 (nucleobase transporters), member 1, solute carrier family 23 (nucleobase transporters), member 2, solute carrier family 23 member 2, SVCT2NBTL1, Yolk sac permease-like molecule 2, YSPL2hSVCT2 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-98 of human SLC23A2 (NP_005107.4). MMGIGKNTTSKSMEAGSSTEGKYEDEAKHPAFFTLPVVINGGATSSGEQDNEDTELMAIYTTENGIAEKSSLAETLDSTGSLDPQRSDMIYTIEDVPP | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:1000 - 1:5000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 9962 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title