SLC23A2 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-94907-0.1ml

Product Code. 18647802

Description

SLC23A2 Polyclonal antibody specifically detects SLC23A2 in Human, Mouse samples. It is validated for Western Blot

Specifications

• Antigen: SLC23A2
• Classification: Polyclonal
• Dilution: Western Blot 1:1000 - 1:5000
• Gene Alias: KIAA0238SLC23A1, Na(+)/L-ascorbic acid transporter 2, Nucleobase transporter-like 1 protein, Sodium-dependent vitamin C transporter 2, sodium-dependent vitamin C transporter-2, solute carrier family 23 (nucleobase transporters), member 1, solute carrier family 23 (nucleobase transporters), member 2, solute carrier family 23 member 2, SVCT2NBTL1, Yolk sac permease-like molecule 2, YSPL2hSVCT2
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-98 of human SLC23A2 (NP_005107.4). MMGIGKNTTSKSMEAGSSTEGKYEDEAKHPAFFTLPVVINGGATSSGEQDNEDTELMAIYTTENGIAEKSSLAETLDSTGSLDPQRSDMIYTIEDVPP
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9962
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG