SLC22A9 Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-94143-0.02ml

Product Code. 18633252

Description

SLC22A9 Polyclonal antibody specifically detects SLC22A9 in Human, Mouse samples. It is validated for Western Blot

Specifications

• Antigen: SLC22A9
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:2000
• Gene Alias: FLJ23666, HOAT4, OAT4UST3H, OAT7, Organic anion transporter 4, organic anion transporter 7, solute carrier family 22 (organic anion transporter), member 9, solute carrier family 22 (organic anion/cation transporter), member 9, solute carrier family 22 member 9, UST3
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 40-145 of human SLC22A9 (NP_543142.2). FTAFIPGHRCWVHILDNDTVSDNDTGALSQDALLRISIPLDSNMRPEKCRRFVHPQWQLLHLNGTFPNTSDADMEPCVDGWVYDRISFSSTIVTEWDLVCDSQSLT
• Quantity: 0.02 mL
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 114571
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG