missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC22A3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35881-20ul
This item is not returnable.
View return policy
Description
SLC22A3 Polyclonal antibody specifically detects SLC22A3 in Mouse samples. It is validated for ELISA,Western Blot
Specifications
| SLC22A3 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| EMTEMTH, Extraneuronal monoamine transporter, OCT3EMT organic cation transporter 3, Organic cation transporter 3, solute carrier family 22 (extraneuronal monoamine transporter), member 3, solute carrier family 22 member 3 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 289-349 of human SLC22A3 (NP_068812.1).,, Sequence:, PESPRWLITRKKGDKALQILRRIAKCNGKYLSSNYSEITVTDEEVSNPSFLDLVRTPQMRK | |
| 20 μL | |
| Primary | |
| Mouse | |
| Purified |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 6581 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction