SLC17A4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-57090

Product Code. 18285032

Description

SLC17A4 Polyclonal specifically detects SLC17A4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SLC17A4
• Classification: Polyclonal
• Dilution: Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: KAIA2138, KIAA2138, MGC129623, Na/PO4 cotransporter, putative small intestine sodium-dependent phosphate transport protein, solute carrier family 17 (sodium phosphate), member 4, Solute carrier family 17 member 4
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10050
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: SLC17A4
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YDDPVNHPFISAGEKRYIVCSLAQQDCSPGWSLPIRA
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only