SLC10A7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-59875

Product Code. 18255975

Description

SLC10A7 Polyclonal specifically detects SLC10A7 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SLC10A7
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C4orf13, chromosome 4 open reading frame 13, DKFZp313H0531, DKFZp566M114, DKFZp779O2438, MGC25043, Na(+)/bile acid cotransporter 7, P7, SBF-domain containing protein, sodium/bile acid cotransporter 7, solute carrier family 10 (sodium/bile acid cotransporter family), member 7, Solute carrier family 10 member 7
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 84068
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q0GE19-2
• Gene Symbols: SLC10A7
• Immunogen: Synthetic peptides corresponding to SLC10A7(solute carrier family 10 (sodium/bile acid cotransporter family), member 7). The peptide sequence was selected from the middle region of SLC10A7. Peptide sequence: TTFCDTFSNPNIDLDKFSLVLILFIIFSIQLSFMLLTFIFSTRNNSGFTP
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Equine: 100%; Rat: 100%; Chicken: 92%; Pig: 92%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG